DPCfam | MC147801
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 350 ± 41 aa |
| Residues in low-complexity regions (%) | 4.91 |
| Residues in coiled-coil regions (%) | 4.96 |
| Predicted disordered residues (%) | 11.27 |
| Average transmembrane regions | 2.19 |
| Dominant Pfam architecture(s) | PF13492 |
| Sequences matching dominant architecture (%) | 16.34 |
| Average overlap percent | 36.53 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U2C8I7 | 307-695 | 389 | NRQEGIFKYVELLVVFLFAELLNHYLGVNVYFRFVDIRLFFIVIMGTIYGMRTGLLAALLECIALFVQYLGIGVDWTLLFYNVEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZE7-F1 | 27-398 | 99.20 | 86.39 | View in AlphaFoldDB ↗ |