DPCfam | MC147692
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 174 ± 30 aa |
| Residues in low-complexity regions (%) | 12.13 |
| Residues in coiled-coil regions (%) | 0.52 |
| Predicted disordered residues (%) | 56.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04782 |
| Sequences matching dominant architecture (%) | 97.06 |
| Average overlap percent | 10.93 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B0PIM0 | 156-306 | 151 | APPPAMPSPEEFAWDFFNPFDEVRREEVVSSSFSGSSQEELRVVREKEGIPDLEEDGERVMSERRVENVTNAGDGGGKSENKNTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6KJG9-F1 | 235-442 | 98.33 | 50.49 | View in AlphaFoldDB ↗ |