DPCfam | MC147630
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00156 |
| Sequences matching dominant architecture (%) | 5.13 |
| Average overlap percent | 6.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D0Z7Q9 | 584-658 | 75 | GGQVIGASALTGKRYSAKMALSAATLARLRTHLGGSNLENWWKQQFGYGFSGLTESEAHYLLRAGDADAIRDRLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q60216-F1 | 170-238 | 98.57 | 87.11 | View in AlphaFoldDB ↗ |