DPCfam | MC147464
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 874 ± 42 aa |
| Residues in low-complexity regions (%) | 17.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.52 |
| Average transmembrane regions | 12.36 |
| Dominant Pfam architecture(s) | PF07732 |
| Sequences matching dominant architecture (%) | 60.0 |
| Average overlap percent | 12.06 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00037A2BF6 | 23-872 | 850 | RQQALPATLWLIALVIISLAHPFIPHNQWILTHTFTLGVLSNSILIWSCQLSDQLLHLRPSPSTFRTRAWIIGGLNLGIVAVLVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q02219-F1 | 20-346 | 36.54 | 93.64 | View in AlphaFoldDB ↗ |