DPCfam | MC147198
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Residues in low-complexity regions (%) | 3.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.31 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00239 |
| Sequences matching dominant architecture (%) | 8.86 |
| Average overlap percent | 90.29 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007A495F1 | 1-88 | 88 | MSLMDSPHRRIAIQRHAEKRGYHYVYTVRPPEGHADPVGYAFNIAIGIHAAAIIVYDLEVVGYSPARVCERFDLETVCPEQTWSR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EMN2-F1 | 5-100 | 98.96 | 94.84 | View in AlphaFoldDB ↗ |