DPCfam | MC147155
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 681 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Residues in low-complexity regions (%) | 2.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02769 |
| Sequences matching dominant architecture (%) | 93.66 |
| Average overlap percent | 68.95 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B6Z0D5 | 2-81 | 80 | GLSKCIPRVLSAGLGASLDANSWNIGPVFGWLTSMAKLSAEDLAYSCSCGVAAVMVVQPSDVESITKTLSEQLVNPVVVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q26255-F1 | 1033-1139 | 98.17 | 92.12 | View in AlphaFoldDB ↗ |