DPCfam | MC146832
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 126 ± 10 aa |
| Residues in low-complexity regions (%) | 3.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07693 |
| Sequences matching dominant architecture (%) | 7.5 |
| Average overlap percent | 17.86 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005BB5198 | 278-401 | 124 | AKLEESMRKVLRPHVQAAAERSVSVRLAVQRTLSLKRARGEGHVRTPADERLEVVSRGMDDGSIALSGPRGVGKTELLTAYCRGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P39115-F1 | 262-345 | 65.38 | 81.81 | View in AlphaFoldDB ↗ |