DPCfam | MC146623
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 284 ± 34 aa |
| Residues in low-complexity regions (%) | 6.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.39 |
| Average transmembrane regions | 5.44 |
| Dominant Pfam architecture(s) | PF02133 |
| Sequences matching dominant architecture (%) | 2.53 |
| Average overlap percent | 31.1 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A157P845 | 232-532 | 301 | ALVTQIGEQVDFLRFLPEKTAANRRRWWIALLCAGPGWIVPGALKMLAGAFLASLVLEHGVPAAKAADPTQMYLIAYGYVFSHPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O06321-F1 | 119-406 | 98.59 | 90.47 | View in AlphaFoldDB ↗ |