DPCfam | MC146462
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 871 |
|---|---|
| Mean domain length (aa) | 142 ± 21 aa |
| Residues in low-complexity regions (%) | 1.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.0 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00780 |
| Sequences matching dominant architecture (%) | 97.01 |
| Average overlap percent | 53.15 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A168N7M6 | 1069-1216 | 148 | KEFYVGADSSAVHFLKARIVVVCPRGFEVIDLENLSMNRNLPDLQHPDFAFVQQRADLKPLGLFKCQEHYLLCYDAFAFLVDTHG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Y7U6-F1 | 1146-1288 | 98.58 | 89.79 | View in AlphaFoldDB ↗ |