DPCfam | MC146432
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 911 |
|---|---|
| Mean domain length (aa) | 106 ± 17 aa |
| Residues in low-complexity regions (%) | 2.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.61 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01875 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 42.89 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1E225 | 221-338 | 118 | LIVISTDFVHHGASFGYQKFTTHILDQVRQIDSAVIESLVHQSLQDFNTVMQETGATVCGKEPLKIVLALIKKKVFQPVESRLTC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VG04-F1 | 174-289 | 97.12 | 98.14 | View in AlphaFoldDB ↗ |