DPCfam | MC146419
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 220 ± 39 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.63 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0VW69 | 31-264 | 234 | QQRFLEFSNRVAAPLAEKYLVIVEELFERLQIAPRSIGSNMLSSFATGRYTLPWNEIIGEFQIRDDKSTQDKMIQLGFLRRYPEY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95XL0-F1 | 351-387 | 15.29 | 70.64 | View in AlphaFoldDB ↗ |