DPCfam | MC146175
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 285 ± 71 aa |
| Residues in low-complexity regions (%) | 14.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12881 |
| Sequences matching dominant architecture (%) | 75.0 |
| Average overlap percent | 60.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A35B745 | 189-478 | 290 | MFGVDTGPPPHCNSTERGLATSQANASPDHTCKSPSVYENFQHWQYLKTLLRRHLPHTPDVEAVSCFLLDQLGMQGKGSGRQLIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1L443-F1 | 165-356 | 61.94 | 66.79 | View in AlphaFoldDB ↗ |