DPCfam | MC146157
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 496 ± 65 aa |
| Residues in low-complexity regions (%) | 3.95 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 11.74 |
| Average transmembrane regions | 6.15 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C4ED93 | 69-591 | 523 | ASDIWGVDVALCNQYCSRQNFPMVFNYQNFLARVTNYLLPWLALTAQLPYEAGDVVPNIMSFFMALGSPMLITFSLMMTILNKRW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2EJT7-F1 | 67-618 | 97.37 | 81.06 | View in AlphaFoldDB ↗ |