DPCfam | MC146086
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 386 ± 48 aa |
| Residues in low-complexity regions (%) | 2.27 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 19.29 |
| Average transmembrane regions | 0.66 |
| Dominant Pfam architecture(s) | PF04597 |
| Sequences matching dominant architecture (%) | 94.49 |
| Average overlap percent | 90.69 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2VK53 | 64-463 | 400 | VQLKVRNIGSTKNYFYYYPIESNLLDKIALYSAVKPFNLKSKKSLQSFHVEIDFFYLKIFIDGGISPNSILNFYLQLTFINNLKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QTB5-F1 | 54-447 | 99.49 | 95.39 | View in AlphaFoldDB ↗ |