DPCfam | MC146043
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Residues in low-complexity regions (%) | 1.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I0AFW7 | 258-340 | 83 | VESYVNTNLTSLQKENLEKTISLIQDFETPFGLELLATIDFIFIQEKFKSNSDWILSEISKWTNRKANLFKSYHIQVAKERLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EQ90-F1 | 261-349 | 94.57 | 94.55 | View in AlphaFoldDB ↗ |