DPCfam | MC145963
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 170 ± 30 aa |
| Residues in low-complexity regions (%) | 5.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11024 |
| Sequences matching dominant architecture (%) | 5.71 |
| Average overlap percent | 8.66 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K2M2U3 | 60-207 | 148 | DSPLLYLDGSLALQGGAQLRVEGNSVSTASVLVMTSAQHKIELSGDGTAVVLAHNRQVEDSYPFSDLAPPNMVVVPPARFVVGCN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4CSF7-F1 | 139-347 | 99.49 | 84.52 | View in AlphaFoldDB ↗ |