DPCfam | MC14545
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 190 ± 20 aa |
| Residues in low-complexity regions (%) | 12.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13174 |
| Sequences matching dominant architecture (%) | 45.0 |
| Average overlap percent | 16.41 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009723AB0 | 786-973 | 188 | LQAIEKALYYYERAVLADPNDPNLMLRIASCFRNSYLPPKQYLGMFEKIYALFPDNLNCVRALVQVTKSLGMAELNEKYSQEYAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A096MK92-F1 | 635-825 | 100.00 | 61.50 | View in AlphaFoldDB ↗ |