DPCfam | MC14523
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 66 ± 9 aa |
| Residues in low-complexity regions (%) | 0.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00728 |
| Sequences matching dominant architecture (%) | 7.33 |
| Average overlap percent | 17.09 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P6H4Z3 | 400-465 | 66 | VFDRYAQVFPSFWISSAFKGAFGETMIVPDVTRHLENNLNWLDVGRTESPKFRQGLRGLAITGWQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H5SHS1-F1 | 320-393 | 98.51 | 88.81 | View in AlphaFoldDB ↗ |