DPCfam | MC144957
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 1145 ± 154 aa |
| Residues in low-complexity regions (%) | 16.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 73.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02213 |
| Sequences matching dominant architecture (%) | 96.72 |
| Average overlap percent | 3.84 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W2RPI9 | 18-1108 | 1091 | GEKRDGGGDWPRSRPNGATQTFRRPSANTTAQLRDTTQQNSTPSPNPGTYIHPHHNTNNAMRNGVPVNTRYSREDCLNIFRGQQE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NSK1-F1 | 6-1323 | 99.92 | 45.63 | View in AlphaFoldDB ↗ |