DPCfam | MC14491
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Residues in low-complexity regions (%) | 13.18 |
| Residues in coiled-coil regions (%) | 2.41 |
| Predicted disordered residues (%) | 37.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15975 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 84.71 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0T5P7M6 | 571-726 | 156 | AEAEKSASEQRAEGDMAEARAAEFRYGVDAEGNRKLNEAENMRNDEARRSAILEAVVNRLPEIIREQVKPMENIESIKILQVDGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P77306-F1 | 417-540 | 97.64 | 65.04 | View in AlphaFoldDB ↗ |