DPCfam | MC144833
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 671 |
|---|---|
| Mean domain length (aa) | 167 ± 18 aa |
| Residues in low-complexity regions (%) | 3.38 |
| Residues in coiled-coil regions (%) | 4.95 |
| Predicted disordered residues (%) | 17.0 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03398 |
| Sequences matching dominant architecture (%) | 94.97 |
| Average overlap percent | 92.8 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W6KZI9 | 11-195 | 185 | FDASKVKANLRMASTRIGIQRKKLSNNLKAQRRGIAELLSNDKYDSARINVEACIRDDLCIEGMEVLSLFLDLLSQRVQLIAEWE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6Z4T7-F1 | 19-190 | 99.42 | 95.96 | View in AlphaFoldDB ↗ |