DPCfam | MC144340
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Residues in low-complexity regions (%) | 3.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.77 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V5BHV3 | 5-118 | 114 | NAKPLKLALHGMDSRAVKTMMLFLQGPCKGEAFVVIDAEDADVDIFDADASNSKKLLENHLQTKIRRPVVVLSLREFVHEGILHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F6R9-F1 | 9-114 | 98.11 | 88.04 | View in AlphaFoldDB ↗ |