DPCfam | MC144106
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2251 |
|---|---|
| Mean domain length (aa) | 253 ± 25 aa |
| Residues in low-complexity regions (%) | 3.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.33 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02645 |
| Sequences matching dominant architecture (%) | 98.92 |
| Average overlap percent | 93.4 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C5CE48 | 7-268 | 262 | DRVLDIPENIAKKKGVYILPIPVYIDGKMYLDGVDITSEEFYRKFHPGVVLKTSAPSLKVIEEFYERIKSDGYDELLFFHVSPEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P32436-F1 | 4-266 | 100.00 | 95.40 | View in AlphaFoldDB ↗ |