DPCfam | MC143973
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1281 |
|---|---|
| Mean domain length (aa) | 252 ± 35 aa |
| Residues in low-complexity regions (%) | 3.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.54 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00763- PF02882 |
| Sequences matching dominant architecture (%) | 91.85 |
| Average overlap percent | 95.13 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C0QAY0 | 7-274 | 268 | GKPVADALKAELTKNIEALKKDKGITPKLGIIRVGARPDDLFYEGGAKKTCAAVGMDCEIFEYPEDIDQASFEKAVTEVGAKKDV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2RIB4-F1 | 11-274 | 100.00 | 97.22 | View in AlphaFoldDB ↗ |