DPCfam | MC143875
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Residues in low-complexity regions (%) | 0.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.08 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14311 |
| Sequences matching dominant architecture (%) | 3.23 |
| Average overlap percent | 1.9 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N1FP29 | 111-223 | 113 | KFCATHGIDLAGPSKVYVITHQEWKAVKIGIGACTGYTSRLVQHERQGWQMHQARDYTTGAAAYDVEQAVLGRLRQAGLTPFLTS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2NW13-F1 | 7-92 | 70.27 | 96.37 | View in AlphaFoldDB ↗ |