DPCfam | MC143633
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 402 ± 30 aa |
| Residues in low-complexity regions (%) | 2.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00144 |
| Sequences matching dominant architecture (%) | 96.83 |
| Average overlap percent | 15.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5S2C8 | 264-661 | 398 | EDLCKFADSFSKDLIILSTQSRLEMLSAQPSELQGKLQGQGFPFGLGWDYADIEPYSGEELRLYGKSGGTGQYSAMLYTIPSQRI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2U5-F1 | 271-433 | 37.56 | 89.25 | View in AlphaFoldDB ↗ |