DPCfam | MC143602
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Residues in low-complexity regions (%) | 1.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01717 |
| Sequences matching dominant architecture (%) | 65.45 |
| Average overlap percent | 21.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A081BH29 | 56-117 | 62 | KQVDLGYKAVTDGEFRRSWWHLDFFDGLKGAHFFEPEKGFIFHGLETRKGGVKITDKLAYNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GN30-F1 | 53-119 | 100.00 | 92.69 | View in AlphaFoldDB ↗ |