DPCfam | MC143028
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Residues in low-complexity regions (%) | 2.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.25 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04762 |
| Sequences matching dominant architecture (%) | 98.72 |
| Average overlap percent | 21.36 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D1V3G1 | 55-146 | 92 | QAVPPEHFHIAGTEFLVAENAVFLATAEGSLLICWGAEMSIVGHVPAGISAVKWSPEQEILVITTKPEHDSGHLLLMTSDWTVIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8WND5-F1 | 70-148 | 96.43 | 92.86 | View in AlphaFoldDB ↗ |