DPCfam | MC143006
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1331 |
|---|---|
| Mean domain length (aa) | 273 ± 47 aa |
| Residues in low-complexity regions (%) | 2.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03102- PF08666 |
| Sequences matching dominant architecture (%) | 37.61 |
| Average overlap percent | 88.23 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T0SHY8 | 18-258 | 241 | VIAGPCSAESEEQVLAIARQLKESGKVDAFRAGIWKPRTRPNTFEGVGLVGLPWMEKVKAETGLPITTEVANASHVELALKHNVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58465-F1 | 19-297 | 99.62 | 97.72 | View in AlphaFoldDB ↗ |