DPCfam | MC142794
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1071 |
|---|---|
| Mean domain length (aa) | 450 ± 64 aa |
| Residues in low-complexity regions (%) | 8.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.73 |
| Average transmembrane regions | 9.21 |
| Dominant Pfam architecture(s) | PF00367- PF02378 |
| Sequences matching dominant architecture (%) | 47.65 |
| Average overlap percent | 90.01 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0MGY2 | 13-455 | 443 | KNIISNVGGVENINSLTHCVTRLRFVLKEKEKVDKDTIDNLDGVTSSLYSGGQYQVIIGQDVADVFEDIISNYELNGTKKGAADT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KF90-F1 | 7-462 | 100.00 | 88.31 | View in AlphaFoldDB ↗ |