DPCfam | MC14268
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Residues in low-complexity regions (%) | 3.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08468 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 74.03 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A1SZ19 | 7-131 | 125 | TFSNPSRVLQRNESLFTNKNILVAGNIDDEYPLQLQALANSSTFCFSDYRYYSVLKDKLTTSEVHFTDNYQGETKFDLLLIFLPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5F942-F1 | 5-125 | 98.39 | 95.49 | View in AlphaFoldDB ↗ |