DPCfam | MC142569
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 151 ± 32 aa |
| Residues in low-complexity regions (%) | 5.15 |
| Residues in coiled-coil regions (%) | 27.62 |
| Predicted disordered residues (%) | 23.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05600 |
| Sequences matching dominant architecture (%) | 96.4 |
| Average overlap percent | 37.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S8X3Y1 | 256-504 | 249 | VRSWKDIVETYEKHNLHIAEISEKVQEIAAEQVPRCRFTISDRQKLITVSRFVNMGFASKDLRQKVKEQTLNVMKKEEALEKSCK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q99LM2-F1 | 94-252 | 99.38 | 94.01 | View in AlphaFoldDB ↗ |