DPCfam | MC142276
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Residues in low-complexity regions (%) | 10.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.05 |
| Average transmembrane regions | 1.16 |
| Dominant Pfam architecture(s) | PF03631 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.13 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A091C2G7 | 88-168 | 81 | LLSISALTTIWSASKSINALQKAMNKSLGVEQRAGIVARVLSVLVLIVFLFAMVALSLIIGAGQVFLDAIQPIFQIPDSFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34437-F1 | 82-156 | 92.59 | 83.98 | View in AlphaFoldDB ↗ |