DPCfam | MC142133
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 161 ± 19 aa |
| Residues in low-complexity regions (%) | 6.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.28 |
| Average transmembrane regions | 2.52 |
| Dominant Pfam architecture(s) | PF05975 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 46.15 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E78387 | 227-365 | 139 | LRLQAKAAFLQDVRRDSKEKYKFVAFILRDQVVKKPAYPRRKPILFRKSGRIFRKRTAANVLAESGLKSLFRNGQQVKSYLMLTG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O35029-F1 | 220-382 | 96.97 | 82.53 | View in AlphaFoldDB ↗ |