DPCfam | MC141725
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Residues in low-complexity regions (%) | 5.82 |
| Residues in coiled-coil regions (%) | 13.2 |
| Predicted disordered residues (%) | 13.02 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF14276 |
| Sequences matching dominant architecture (%) | 97.2 |
| Average overlap percent | 83.96 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L6W0N4 | 2-126 | 125 | KTFVATLVVFAILVGFSTFTYNYINNTTDDLMAHIQVMEKHLRARNWQQAEQGFSKLKSSWDRTSSNWAVFIDHQELDSINMSMA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P39595-F1 | 6-113 | 88.71 | 73.28 | View in AlphaFoldDB ↗ |