DPCfam | MC14168
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 206 ± 20 aa |
| Residues in low-complexity regions (%) | 3.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08812 |
| Sequences matching dominant architecture (%) | 99.56 |
| Average overlap percent | 91.49 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7Z0J0 | 53-266 | 214 | AVADFIMKKKRNEWICNQLQQAYFFRAEEEQNRILEIVAGMLKGERPELTDLAGGIEERAAIEGAVAPLVGESCTLPLASVLTFR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P06569-F1 | 60-267 | 98.14 | 88.73 | View in AlphaFoldDB ↗ |