DPCfam | MC141605
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 901 |
|---|---|
| Mean domain length (aa) | 181 ± 27 aa |
| Residues in low-complexity regions (%) | 5.47 |
| Residues in coiled-coil regions (%) | 1.42 |
| Predicted disordered residues (%) | 1.69 |
| Average transmembrane regions | 5.32 |
| Dominant Pfam architecture(s) | PF03083- PF03083 |
| Sequences matching dominant architecture (%) | 72.37 |
| Average overlap percent | 93.65 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F0Y6Y6 | 70-260 | 191 | VVANAMFLASLPAVLAARRAGDLGSLNPTPWAFILVNCLAWLHYGYLNGNPYIYWSNAPGCLLGLFFTLTGASLGSPAQVAAMEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B6T9M1-F1 | 20-217 | 99.47 | 97.59 | View in AlphaFoldDB ↗ |