DPCfam | MC141569
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 521 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Residues in low-complexity regions (%) | 9.96 |
| Residues in coiled-coil regions (%) | 0.72 |
| Predicted disordered residues (%) | 4.07 |
| Average transmembrane regions | 3.02 |
| Dominant Pfam architecture(s) | PF10011 |
| Sequences matching dominant architecture (%) | 97.47 |
| Average overlap percent | 44.11 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q9M1M5 | 51-175 | 125 | DSASGTLSAVATGLVTVTSITFSVLLLAVQQTASTLSPVVFDQFVRRRTNQLYLGLFVGLALYSYIVLAAVQKKTPPVIGAFIAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FD56-F1 | 29-164 | 90.41 | 83.54 | View in AlphaFoldDB ↗ |