DPCfam | MC141562
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 71 ± 15 aa |
| Residues in low-complexity regions (%) | 8.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.86 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00428 |
| Sequences matching dominant architecture (%) | 87.04 |
| Average overlap percent | 55.88 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183HKG4 | 7-67 | 61 | MKYLAAYLLSTMGGNKSPTAKDIENVLGSVGLDVDMEDANKVVSALSGKSIDEVIAAGLTK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P05387-F1 | 1-71 | 98.61 | 83.60 | View in AlphaFoldDB ↗ |