DPCfam | MC141373
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Residues in low-complexity regions (%) | 0.57 |
| Residues in coiled-coil regions (%) | 0.76 |
| Predicted disordered residues (%) | 18.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15300 |
| Sequences matching dominant architecture (%) | 98.63 |
| Average overlap percent | 85.25 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L9J9D6 | 176-247 | 72 | AQGINADIKHQLMKEVRKFGRKYERIFILLEEVQGPLEMKKQFVEFTIKEAARFKRRVLIQYLEKVLEKIDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BND4-F1 | 775-844 | 97.22 | 84.10 | View in AlphaFoldDB ↗ |