DPCfam | MC141295
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 220 ± 26 aa |
| Residues in low-complexity regions (%) | 1.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.19 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A163J1T0 | 980-1228 | 249 | VIRELETRQSRNHIPARTSEAQDIYEFMLEKAGSDTEWQLIKAAFSEKRLVLGENGAWHALGTCLWRSPFALADFQDLSTMYPNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VTH7-F1 | 908-1129 | 98.22 | 84.60 | View in AlphaFoldDB ↗ |