DPCfam | MC141080
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Residues in low-complexity regions (%) | 3.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02522 |
| Sequences matching dominant architecture (%) | 97.98 |
| Average overlap percent | 36.49 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V8NJK7 | 212-271 | 60 | QWVTYAEPDVDSDDFEALGQAYGQVSQALVVGKVGLATALYMPQRELVEFGVAWLKAHRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O32003-F1 | 203-266 | 96.97 | 97.69 | View in AlphaFoldDB ↗ |