DPCfam | MC140858
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 176 ± 32 aa |
| Residues in low-complexity regions (%) | 3.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.63 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W4XLQ3 | 385-549 | 165 | GSTLAVEVLCMDSKATVVWQDGTEERDIPTTQLNYSISLDDHEFYPGEWVVEEGKSETLYGVVQSVDHTERTAKVKWFTRIGQED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7N2S7-F1 | 484-686 | 98.19 | 74.98 | View in AlphaFoldDB ↗ |