DPCfam | MC140645
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 156 ± 17 aa |
| Residues in low-complexity regions (%) | 6.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13582 |
| Sequences matching dominant architecture (%) | 4.76 |
| Average overlap percent | 14.97 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D5C2X4 | 344-522 | 179 | GFAEKLGNDFGISYGGWPSGVPTHSAYQSGTIMHEIGHNLGLDHGGDYADPLNCKPNYVSVMSYSRQLPTIYAQPLIDFSNATIQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ER02-F1 | 193-329 | 97.16 | 96.66 | View in AlphaFoldDB ↗ |