DPCfam | MC140636
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Residues in low-complexity regions (%) | 1.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00439 |
| Sequences matching dominant architecture (%) | 33.33 |
| Average overlap percent | 7.25 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3XA02 | 592-683 | 92 | EIRLPRQAYQGYIKEYEGATLMGCELYPNVVYKEFSEVISRQREIISRIIDRRKRALETVYPGIPNSQFRLGPIPLSSIPGLIEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8WZM0-F1 | 256-372 | 100.00 | 89.44 | View in AlphaFoldDB ↗ |