DPCfam | MC14046
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 465 ± 115 aa |
| Residues in low-complexity regions (%) | 5.53 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 11.04 |
| Average transmembrane regions | 7.26 |
| Dominant Pfam architecture(s) | PF16213 |
| Sequences matching dominant architecture (%) | 1.96 |
| Average overlap percent | 0.21 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178Z427 | 156-595 | 440 | TQEWINLLGDPASAIFGAFSEIRSDVIMLREISIARRQSKRPYLRHTPWLELLKWVVILVGDTEFTQGSHRQDTEIEMAQAQKGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PZZ9-F1 | 133-1092 | 100.00 | 60.45 | View in AlphaFoldDB ↗ |