DPCfam | MC140045
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Residues in low-complexity regions (%) | 2.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.36 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G3LAP6 | 235-332 | 98 | GEWIDSGEIKIGIFSGDHSKFGIGSLMNSGSIFGTGCNLFSNQGLFPKFVPSFSWGNGIDFKKYVWNDFLENTKKILKRRKKELS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6LYB5-F1 | 352-398 | 48.96 | 98.48 | View in AlphaFoldDB ↗ |