DPCfam | MC140032
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 444 ± 46 aa |
| Residues in low-complexity regions (%) | 2.33 |
| Residues in coiled-coil regions (%) | 0.23 |
| Predicted disordered residues (%) | 17.93 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12919 |
| Sequences matching dominant architecture (%) | 56.25 |
| Average overlap percent | 82.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L4D214 | 135-541 | 407 | AKKILKDLHFVWLGGNLGEIQKSYIEIWAKVNPEYKIHIWYDPNSLYVYQTSSQIRKKIDPNGLISLEDYNIMNTNDIRTFMAKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-T0D3N5-F1 | 84-482 | 96.92 | 89.19 | View in AlphaFoldDB ↗ |