DPCfam | MC139941
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 301 ± 33 aa |
| Residues in low-complexity regions (%) | 3.31 |
| Residues in coiled-coil regions (%) | 3.48 |
| Predicted disordered residues (%) | 21.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02176 |
| Sequences matching dominant architecture (%) | 97.78 |
| Average overlap percent | 18.86 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K9Q1E0 | 22-338 | 317 | PSFRCLLCNTEVVHKIAHVLLQGLATSCVDNTTGDFFKEPRSVAVDIRKEMVDYLTERSESIIAESFLLQQEGGGGDEVIEVSDH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1NAY7-F1 | 28-341 | 99.68 | 90.74 | View in AlphaFoldDB ↗ |