DPCfam | MC139680
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Residues in low-complexity regions (%) | 2.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00171 |
| Sequences matching dominant architecture (%) | 13.26 |
| Average overlap percent | 26.26 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8PYP2 | 362-423 | 62 | FIGLVDSSSVMVNASTRFADGYRYGKGAEVGISTNKIHSRGPVGMEGLLIYKYILMGKGQVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q67LC2-F1 | 364-425 | 100.00 | 95.75 | View in AlphaFoldDB ↗ |